Lineage for d1kgsa1 (1kgs A:124-225)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95524Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families) (S)
  5. 95525Family a.4.6.1: PhoB-like [46895] (2 proteins)
  6. 95530Protein PhoB [46898] (2 species)
  7. 95533Species Thermotoga maritima [TaxId:243274] [68972] (1 PDB entry)
  8. 95534Domain d1kgsa1: 1kgs A:124-225 [68596]
    Other proteins in same PDB: d1kgsa2

Details for d1kgsa1

PDB Entry: 1kgs (more details), 1.5 Å

PDB Description: Crystal Structure at 1.50 A of an OmpR/PhoB Homolog from Thermotoga maritima

SCOP Domain Sequences for d1kgsa1:

Sequence, based on SEQRES records: (download)

>d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima}
skstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwsf
ddevfsdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde

Sequence, based on observed residues (ATOM records): (download)

>d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima}
skstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwvf
sdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde

SCOP Domain Coordinates for d1kgsa1:

Click to download the PDB-style file with coordinates for d1kgsa1.
(The format of our PDB-style files is described here.)

Timeline for d1kgsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgsa2