Lineage for d1kfqa4 (1kfq A:444-572)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431204Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 1431205Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 1431206Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69811] (1 species)
  7. 1431207Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [69812] (2 PDB entries)
  8. 1431210Domain d1kfqa4: 1kfq A:444-572 [68566]
    Other proteins in same PDB: d1kfqa1, d1kfqa2, d1kfqa3, d1kfqb1, d1kfqb2, d1kfqb3
    complexed with ca

Details for d1kfqa4

PDB Entry: 1kfq (more details), 2.4 Å

PDB Description: crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. open form
PDB Compounds: (A:) phosphoglucomutase 1

SCOPe Domain Sequences for d1kfqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfqa4 d.129.2.1 (A:444-572) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
rnyysrydyeqvdsagankmmehlktkfqyfeqlkqgnkadiydyvdpvdqsvsknqgvr
fvfgdgsriifrlsgtgsvgatiriyfeqfeqqqiqhetatalaniiklgleisdiaqft
grneptvit

SCOPe Domain Coordinates for d1kfqa4:

Click to download the PDB-style file with coordinates for d1kfqa4.
(The format of our PDB-style files is described here.)

Timeline for d1kfqa4: