| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein CMP kinase [52548] (3 species) |
| Species Escherichia coli [TaxId:562] [52549] (6 PDB entries) |
| Domain d1kdta_: 1kdt A: [68484] complexed with doc, so4 |
PDB Entry: 1kdt (more details), 1.95 Å
SCOPe Domain Sequences for d1kdta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdta_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqkla
Timeline for d1kdta_: