Lineage for d1kdta_ (1kdt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865762Protein CMP kinase [52548] (3 species)
  7. 2865763Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 2865765Domain d1kdta_: 1kdt A: [68484]
    complexed with doc, so4

Details for d1kdta_

PDB Entry: 1kdt (more details), 1.95 Å

PDB Description: cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d1kdta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdta_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqkla

SCOPe Domain Coordinates for d1kdta_:

Click to download the PDB-style file with coordinates for d1kdta_.
(The format of our PDB-style files is described here.)

Timeline for d1kdta_: