Lineage for d1kczb1 (1kcz B:161-413)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973407Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 973472Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 973473Protein beta-Methylaspartase [69400] (2 species)
  7. 973479Species Clostridium tetanomorphum [TaxId:1553] [69401] (2 PDB entries)
  8. 973481Domain d1kczb1: 1kcz B:161-413 [68453]
    Other proteins in same PDB: d1kcza2, d1kczb2
    complexed with edo, mg

Details for d1kczb1

PDB Entry: 1kcz (more details), 1.9 Å

PDB Description: Crystal Structure of beta-methylaspartase from Clostridium tetanomorphum. Mg-complex.
PDB Compounds: (B:) beta-methylaspartase

SCOPe Domain Sequences for d1kczb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kczb1 c.1.11.2 (B:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]}
gaeinavpvfaqsgddrydnvdkmiikeadvlphalinnveeklglkgeklleyvkwlrd
riiklrvredyapifhidvygtigaafdvdikamadyiqtlaeaakpfhlriegpmdved
rqkqmeamrdlraeldgrgvdaelvadewcntvedvkfftdnkaghmvqiktpdlggvnn
iadaimyckangmgaycggtcnetnrsaevttnigmacgarqvlakpgmgvdegmmivkn
emnrvlalvgrrk

SCOPe Domain Coordinates for d1kczb1:

Click to download the PDB-style file with coordinates for d1kczb1.
(The format of our PDB-style files is described here.)

Timeline for d1kczb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kczb2