| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins) |
| Protein beta-Methylaspartase [69400] (2 species) |
| Species Clostridium tetanomorphum [TaxId:1553] [69401] (2 PDB entries) |
| Domain d1kczb1: 1kcz B:161-413 [68453] Other proteins in same PDB: d1kcza2, d1kczb2 complexed with edo, mg |
PDB Entry: 1kcz (more details), 1.9 Å
SCOPe Domain Sequences for d1kczb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kczb1 c.1.11.2 (B:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]}
gaeinavpvfaqsgddrydnvdkmiikeadvlphalinnveeklglkgeklleyvkwlrd
riiklrvredyapifhidvygtigaafdvdikamadyiqtlaeaakpfhlriegpmdved
rqkqmeamrdlraeldgrgvdaelvadewcntvedvkfftdnkaghmvqiktpdlggvnn
iadaimyckangmgaycggtcnetnrsaevttnigmacgarqvlakpgmgvdegmmivkn
emnrvlalvgrrk
Timeline for d1kczb1: