Lineage for d1kcgb_ (1kcg B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264459Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 264460Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 264461Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 264639Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 264640Species Human (Homo sapiens) [TaxId:9606] [64455] (2 PDB entries)
  8. 264644Domain d1kcgb_: 1kcg B: [68439]
    Other proteins in same PDB: d1kcgc_
    complexed with gsh

Details for d1kcgb_

PDB Entry: 1kcg (more details), 2.6 Å

PDB Description: NKG2D in complex with ULBP3

SCOP Domain Sequences for d1kcgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcgb_ d.169.1.1 (B:) NK cell-activating receptor nkg2d {Human (Homo sapiens)}
esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
qrt

SCOP Domain Coordinates for d1kcgb_:

Click to download the PDB-style file with coordinates for d1kcgb_.
(The format of our PDB-style files is described here.)

Timeline for d1kcgb_: