Lineage for d1kbva2 (1kbv A:164-314)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224695Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 224767Protein Nitrite reductase, NIR [49551] (4 species)
    consists of two domains of this fold
  7. 224917Species Neisseria gonorrhoeae, AniA [TaxId:485] [69193] (2 PDB entries)
  8. 224919Domain d1kbva2: 1kbv A:164-314 [68396]

Details for d1kbva2

PDB Entry: 1kbv (more details), 1.95 Å

PDB Description: nitrite-soaked crystal structure of the soluble domain of ania from neisseria gonorrhoeae

SCOP Domain Sequences for d1kbva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim

SCOP Domain Coordinates for d1kbva2:

Click to download the PDB-style file with coordinates for d1kbva2.
(The format of our PDB-style files is described here.)

Timeline for d1kbva2: