Class a: All alpha proteins [46456] (285 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.6: Quinoprotein alcohol dehydrogenase, C-terminal domain [68952] (1 protein) |
Protein Quinoprotein alcohol dehydrogenase, C-terminal domain [68953] (2 species) |
Species Comamonas testosteroni [TaxId:285] [68954] (1 PDB entry) |
Domain d1kb0a1: 1kb0 A:579-675 [68378] Other proteins in same PDB: d1kb0a2 complexed with ca, gol, hec, pqq, tfb |
PDB Entry: 1kb0 (more details), 1.44 Å
SCOPe Domain Sequences for d1kb0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb0a1 a.3.1.6 (A:579-675) Quinoprotein alcohol dehydrogenase, C-terminal domain {Comamonas testosteroni [TaxId: 285]} tgqllqgvkydpakveagtmlyvancvfchgvpgvdrggnipnlgymdasyienlpnfvf kgpamvrgmpdftgklsgddveslkafiqgtadairp
Timeline for d1kb0a1: