SCOPe 2.08: Domain d1kb0a1: 1kb0 A:579-675

Lineage for d1kb0a1 (1kb0 A:579-675)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.6: Quinoprotein alcohol dehydrogenase, C-terminal domain [68952] (1 protein)

6. Protein Quinoprotein alcohol dehydrogenase, C-terminal domain [68953] (2 species)

7. Species Comamonas testosteroni [TaxId:285] [68954] (1 PDB entry)

8. Domain d1kb0a1: 1kb0 A:579-675 [68378]
   Other proteins in same PDB: d1kb0a2
   complexed with ca, gol, hec, pqq, tfb

Details for d1kb0a1

PDB Entry: 1kb0, 1.44 Å

PDB Description: Crystal Structure of Quinohemoprotein Alcohol Dehydrogenase from Comamonas testosteroni

PDB Compounds: (A:) quinohemoprotein alcohol dehydrogenase

SCOPe Domain Sequences for d1kb0a1:

Sequence; same for both SEQRES and ATOM records:

>d1kb0a1 a.3.1.6 (A:579-675) Quinoprotein alcohol dehydrogenase, C-terminal domain {Comamonas testosteroni [TaxId: 285]}
tgqllqgvkydpakveagtmlyvancvfchgvpgvdrggnipnlgymdasyienlpnfvf
kgpamvrgmpdftgklsgddveslkafiqgtadairp

Timeline for d1kb0a1:

• d1kb0a1 first appeared in SCOP 1.59
  
• d1kb0a1 appears in SCOPe 2.07