Lineage for d1kb0a1 (1kb0 A:579-675)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691574Family a.3.1.6: Quinoprotein alcohol dehydrogenase, C-terminal domain [68952] (1 protein)
  6. 2691575Protein Quinoprotein alcohol dehydrogenase, C-terminal domain [68953] (2 species)
  7. 2691576Species Comamonas testosteroni [TaxId:285] [68954] (1 PDB entry)
  8. 2691577Domain d1kb0a1: 1kb0 A:579-675 [68378]
    Other proteins in same PDB: d1kb0a2
    complexed with ca, gol, hec, pqq, tfb

Details for d1kb0a1

PDB Entry: 1kb0 (more details), 1.44 Å

PDB Description: Crystal Structure of Quinohemoprotein Alcohol Dehydrogenase from Comamonas testosteroni
PDB Compounds: (A:) quinohemoprotein alcohol dehydrogenase

SCOPe Domain Sequences for d1kb0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb0a1 a.3.1.6 (A:579-675) Quinoprotein alcohol dehydrogenase, C-terminal domain {Comamonas testosteroni [TaxId: 285]}
tgqllqgvkydpakveagtmlyvancvfchgvpgvdrggnipnlgymdasyienlpnfvf
kgpamvrgmpdftgklsgddveslkafiqgtadairp

SCOPe Domain Coordinates for d1kb0a1:

Click to download the PDB-style file with coordinates for d1kb0a1.
(The format of our PDB-style files is described here.)

Timeline for d1kb0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kb0a2