Lineage for d1k9ib_ (1k9i B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940590Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species)
  7. 1940591Species Human (Homo sapiens) [TaxId:9606] [69856] (6 PDB entries)
    Uniprot Q9NNX6 253-384
  8. 1940597Domain d1k9ib_: 1k9i B: [68344]
    complexed with ca

Details for d1k9ib_

PDB Entry: 1k9i (more details), 2.5 Å

PDB Description: complex of dc-sign and glcnac2man3
PDB Compounds: (B:) mDC-SIGN1B type I isoform

SCOPe Domain Sequences for d1k9ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ib_ d.169.1.1 (B:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]}
pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft
wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf
wickksaa

SCOPe Domain Coordinates for d1k9ib_:

Click to download the PDB-style file with coordinates for d1k9ib_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ib_: