Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) [69855] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69856] (6 PDB entries) Uniprot Q9NNX6 253-384 |
Domain d1k9ib_: 1k9i B: [68344] complexed with ca |
PDB Entry: 1k9i (more details), 2.5 Å
SCOPe Domain Sequences for d1k9ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9ib_ d.169.1.1 (B:) DC-SIGN (dendritic cell-specific ICAM-3 grabbing nonintegrin) {Human (Homo sapiens) [TaxId: 9606]} pcpwewtffqgncyfmsnsqrnwhdsitackevgaqlvviksaeeqnflqlqssrsnrft wmglsdlnqegtwqwvdgspllpsfkqywnrgepnnvgeedcaefsgngwnddkcnlakf wickksaa
Timeline for d1k9ib_: