SCOP 1.63: Domain d1k92a1: 1k92 A:1-188

Lineage for d1k92a1 (1k92 A:1-188)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   the first three families are more closely related to each other as the last two families are

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins)

6. Protein Argininosuccinate synthetase, N-terminal domain [69458] (2 species)

7. Species Escherichia coli [TaxId:562] [69459] (4 PDB entries)

8. Domain d1k92a1: 1k92 A:1-188 [68325]
   Other proteins in same PDB: d1k92a2
   complexed with cry, so4; mutant

Details for d1k92a1

PDB Entry: 1k92, 1.6 Å

PDB Description: Crystal Structure of Uncomplexed E. coli Argininosuccinate Synthetase

SCOP Domain Sequences for d1k92a1:

Sequence; same for both SEQRES and ATOM records:

>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli}
ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
dykmsvek

Timeline for d1k92a1:

• d1k92a1 first appeared in SCOP 1.59
  
• d1k92a1 appears in SCOP 1.61
  
• d1k92a1 appears in SCOP 1.65
  
• d1k92a1 appears in the current release, SCOPe 2.08