Lineage for d1k92a1 (1k92 A:1-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861265Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)
  7. 2861266Species Escherichia coli [TaxId:562] [69459] (4 PDB entries)
  8. 2861267Domain d1k92a1: 1k92 A:1-188 [68325]
    Other proteins in same PDB: d1k92a2
    complexed with gol, so4

Details for d1k92a1

PDB Entry: 1k92 (more details), 1.6 Å

PDB Description: Crystal Structure of Uncomplexed E. coli Argininosuccinate Synthetase
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d1k92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}
ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
dykmsvek

SCOPe Domain Coordinates for d1k92a1:

Click to download the PDB-style file with coordinates for d1k92a1.
(The format of our PDB-style files is described here.)

Timeline for d1k92a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k92a2