Lineage for d1k83c1 (1k83 C:3-41,C:173-268)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865191Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 865274Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 865275Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 865328Protein RPB3 [64315] (1 species)
  7. 865329Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 865332Domain d1k83c1: 1k83 C:3-41,C:173-268 [68277]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
    complexed with ilx, mn, trx, zn

Details for d1k83c1

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kd polypeptide

SCOP Domain Sequences for d1k83c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83c1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

SCOP Domain Coordinates for d1k83c1:

Click to download the PDB-style file with coordinates for d1k83c1.
(The format of our PDB-style files is described here.)

Timeline for d1k83c1: