Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.74: DCoH-like [55247] (4 superfamilies) |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
Protein RPB3 [64315] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (4 PDB entries) |
Domain d1k83c1: 1k83 C:3-41,C:173-268 [68277] Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_ |
PDB Entry: 1k83 (more details), 2.8 Å
SCOP Domain Sequences for d1k83c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k83c1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae)} eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq kkvasillaltqmdqd
Timeline for d1k83c1: