SCOPe 2.01: Domain d1k83c1: 1k83 C:3-41,C:173-268

Lineage for d1k83c1 (1k83 C:3-41,C:173-268)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d1k83c1: 1k83 C:3-41,C:173-268 [68277]
   Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_
   protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d1k83c1

PDB Entry: 1k83, 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

PDB Compounds: (C:) DNA-directed RNA polymerase II 45kd polypeptide

SCOPe Domain Sequences for d1k83c1:

Sequence; same for both SEQRES and ATOM records:

>d1k83c1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw
yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq
kkvasillaltqmdqd

Timeline for d1k83c1:

• d1k83c1 first appeared in SCOP 1.59
  
• d1k83c1 appears in SCOP 1.75
  
• d1k83c1 appears in SCOPe 2.02
  
• d1k83c1 appears in the current release, SCOPe 2.08