SCOP 1.67: Domain d1k78e1: 1k78 E:19-81

Lineage for d1k78e1 (1k78 E:19-81)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (12 families)
   consists only of helices

5. Family a.4.1.5: Paired domain [46748] (3 proteins)
   duplication: consists of two domains of this fold

6. Protein Pax-5 [68962] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [68963] (2 PDB entries)

8. Domain d1k78e1: 1k78 E:19-81 [68258]
   Other proteins in same PDB: d1k78b_, d1k78f_

Details for d1k78e1

PDB Entry: 1k78, 2.25 Å

PDB Description: Pax5(1-149)+Ets-1(331-440)+DNA

SCOP Domain Sequences for d1k78e1:

Sequence; same for both SEQRES and ATOM records:

>d1k78e1 a.4.1.5 (E:19-81) Pax-5 {Human (Homo sapiens)}
gvnqlggvfvngrplpdvvrqrivelahqgvrpcdisrqlrvshgcvskilgryyetgsi
kpg

Timeline for d1k78e1:

• d1k78e1 first appeared in SCOP 1.59
  
• d1k78e1 appears in SCOP 1.65
  
• d1k78e1 appears in SCOP 1.69
  
• d1k78e1 appears in the current release, SCOPe 2.08