Lineage for d1k6yb1 (1k6y B:1-46)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150558Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (1 family) (S)
  5. 150559Family a.4.10.1: N-terminal Zn binding domain of HIV integrase [46920] (1 protein)
  6. 150560Protein N-terminal Zn binding domain of HIV integrase [46921] (2 species)
  7. 150561Species Human immunodeficiency virus type 1 [TaxId:11676] [46922] (7 PDB entries)
  8. 150563Domain d1k6yb1: 1k6y B:1-46 [68241]
    Other proteins in same PDB: d1k6ya2, d1k6yb2, d1k6yc2, d1k6yd2

Details for d1k6yb1

PDB Entry: 1k6y (more details), 2.4 Å

PDB Description: Crystal Structure of a Two-Domain Fragment of HIV-1 Integrase

SCOP Domain Sequences for d1k6yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6yb1 a.4.10.1 (B:1-46) N-terminal Zn binding domain of HIV integrase {Human immunodeficiency virus type 1}
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlk

SCOP Domain Coordinates for d1k6yb1:

Click to download the PDB-style file with coordinates for d1k6yb1.
(The format of our PDB-style files is described here.)

Timeline for d1k6yb1: