Lineage for d1k6oc_ (1k6o C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569729Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2569730Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 2569731Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2569758Protein Serum response factor (SRF) core [55457] (1 species)
  7. 2569759Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)
  8. 2569763Domain d1k6oc_: 1k6o C: [68228]
    Other proteins in same PDB: d1k6oa_
    protein/DNA complex

Details for d1k6oc_

PDB Entry: 1k6o (more details), 3.19 Å

PDB Description: crystal structure of a ternary sap-1/srf/c-fos sre dna complex
PDB Compounds: (C:) serum response factor

SCOPe Domain Sequences for d1k6oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6oc_ d.88.1.1 (C:) Serum response factor (SRF) core {Human (Homo sapiens) [TaxId: 9606]}
kktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytf
atrklqpmitsetgkaliqtclns

SCOPe Domain Coordinates for d1k6oc_:

Click to download the PDB-style file with coordinates for d1k6oc_.
(The format of our PDB-style files is described here.)

Timeline for d1k6oc_: