Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
Superfamily d.88.1: SRF-like [55455] (1 family) |
Family d.88.1.1: SRF-like [55456] (5 proteins) |
Protein Serum response factor (SRF) core [55457] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries) |
Domain d1k6oc_: 1k6o C: [68228] Other proteins in same PDB: d1k6oa_ protein/DNA complex |
PDB Entry: 1k6o (more details), 3.19 Å
SCOPe Domain Sequences for d1k6oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6oc_ d.88.1.1 (C:) Serum response factor (SRF) core {Human (Homo sapiens) [TaxId: 9606]} kktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytf atrklqpmitsetgkaliqtclns
Timeline for d1k6oc_: