SCOPe 2.06: Domain d1k6oa_: 1k6o A:

Lineage for d1k6oa_ (1k6o A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein Serum response factor accessory protein 1a, SAP-1 [46869] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries)

8. Domain d1k6oa_: 1k6o A: [68226]
   Other proteins in same PDB: d1k6ob_, d1k6oc_
   protein/DNA complex

Details for d1k6oa_

PDB Entry: 1k6o, 3.19 Å

PDB Description: crystal structure of a ternary sap-1/srf/c-fos sre dna complex

PDB Compounds: (A:) ets-domain protein elk-4

SCOPe Domain Sequences for d1k6oa_:

Sequence; same for both SEQRES and ATOM records:

>d1k6oa_ a.4.5.21 (A:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]}
saitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsra
lryyyvkniikkvngqkfvykfvsypeil

Timeline for d1k6oa_:

• d1k6oa_ first appeared in SCOP 1.59
  
• d1k6oa_ appears in SCOPe 2.05
  
• d1k6oa_ appears in SCOPe 2.07
  
• d1k6oa_ appears in the current release, SCOPe 2.08