Lineage for d1k6oa_ (1k6o A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families) 
Family a.4.5.21: ets domain [46859] (6 proteins) 
Protein Serum responce factor accessory protein 1a, SAP-1 [46869] (1 species) Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries) 
Domain d1k6oa_: 1k6o A: [68226]
Other proteins in same PDB: d1k6ob_, d1k6oc_
Details for d1k6oa_
PDB Entry: 1k6o (more details), 3.19 Å
PDB Description: crystal structure of a ternary sap-1/srf/c-fos sre dna complex
SCOP Domain Sequences for d1k6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6oa_ a.4.5.21 (A:) Serum responce factor accessory protein 1a, SAP-1 {Human (Homo sapiens)}
saitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsra
lryyyvkniikkvngqkfvykfvsypeil
SCOP Domain Coordinates for d1k6oa_:
Click to download the PDB-style file with coordinates for d1k6oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k6oa_:
- d1k6oa_ first appeared in SCOP 1.59
- d1k6oa_ appears in SCOP 1.63
- d1k6oa_ appears in the current release, SCOPe 2.08
View in 3D
