Class b: All beta proteins [48724] (174 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller) |
Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein) |
Protein Tricorn protease N-terminal domain [69306] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries) |
Domain d1k32e2: 1k32 E:39-319 [68085] Other proteins in same PDB: d1k32a1, d1k32a3, d1k32a4, d1k32b1, d1k32b3, d1k32b4, d1k32c1, d1k32c3, d1k32c4, d1k32d1, d1k32d3, d1k32d4, d1k32e1, d1k32e3, d1k32e4, d1k32f1, d1k32f3, d1k32f4 |
PDB Entry: 1k32 (more details), 2 Å
SCOPe Domain Sequences for d1k32e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k32e2 b.68.7.1 (E:39-319) Tricorn protease N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl ntdgrrilfskggsiyifnpdtekiekieigdlespedrii
Timeline for d1k32e2: