Lineage for d1k32b2 (1k32 B:39-319)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134683Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1135189Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) (S)
    possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller)
  5. 1135190Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein)
  6. 1135191Protein Tricorn protease N-terminal domain [69306] (1 species)
  7. 1135192Species Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries)
  8. 1135194Domain d1k32b2: 1k32 B:39-319 [68073]
    Other proteins in same PDB: d1k32a1, d1k32a3, d1k32a4, d1k32b1, d1k32b3, d1k32b4, d1k32c1, d1k32c3, d1k32c4, d1k32d1, d1k32d3, d1k32d4, d1k32e1, d1k32e3, d1k32e4, d1k32f1, d1k32f3, d1k32f4

Details for d1k32b2

PDB Entry: 1k32 (more details), 2 Å

PDB Description: Crystal structure of the tricorn protease
PDB Compounds: (B:) tricorn protease

SCOPe Domain Sequences for d1k32b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k32b2 b.68.7.1 (B:39-319) Tricorn protease N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
ntdgrrilfskggsiyifnpdtekiekieigdlespedrii

SCOPe Domain Coordinates for d1k32b2:

Click to download the PDB-style file with coordinates for d1k32b2.
(The format of our PDB-style files is described here.)

Timeline for d1k32b2: