Lineage for d1k2yx4 (1k2y X:368-463)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040510Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 1040511Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 1040535Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)
  7. 1040536Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries)
  8. 1040540Domain d1k2yx4: 1k2y X:368-463 [68066]
    Other proteins in same PDB: d1k2yx1, d1k2yx2, d1k2yx3
    complexed with tla, zn; mutant

Details for d1k2yx4

PDB Entry: 1k2y (more details), 1.75 Å

PDB Description: crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. aeruginosa
PDB Compounds: (X:) Phosphomannomutase

SCOPe Domain Sequences for d1k2yx4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2yx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOPe Domain Coordinates for d1k2yx4:

Click to download the PDB-style file with coordinates for d1k2yx4.
(The format of our PDB-style files is described here.)

Timeline for d1k2yx4: