PDB entry 1k2y

View 1k2y on RCSB PDB site
Description: Crystal Structure of Phosphomannomutase/Phosphoglucomutase S108A mutant from P. aeruginosa
Class: isomerase
Keywords: alpha/beta protein, active-site mutant, enzyme-ligand complex, isomerase
Deposited on 2001-09-30, released 2002-02-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Phosphomannomutase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AlgC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26276 (Start-462)
      • engineered (107)
    Domains in SCOPe 2.01: d1k2yx1, d1k2yx2, d1k2yx3, d1k2yx4
  • Heterogens: ZN, TLA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1k2yX (X:)
    mstakaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrls
    gpelvkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgahnppdyngfkiv
    vagetlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcg
    ngvagviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlgla
    fdgdgdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggr
    pvmwktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrds
    ehvfsafpsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglv
    rasnttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2yX (X:)
    kaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpel
    vkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgahnppdyngfkivvage
    tlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgngva
    gviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglafdgd
    gdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmw
    ktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvf
    safpsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasn
    ttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf