SCOP 1.59: Domain d1k0oa1: 1k0o A:92-241

Lineage for d1k0oa1 (1k0o A:92-241)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69034] (3 PDB entries)

8. Domain d1k0oa1: 1k0o A:92-241 [67957]
   Other proteins in same PDB: d1k0oa2, d1k0ob2

Details for d1k0oa1

PDB Entry: 1k0o, 1.75 Å

PDB Description: crystal structure of a soluble form of clic1. an intracellular chloride ion channel

SCOP Domain Sequences for d1k0oa1:

Sequence, based on SEQRES records:

>d1k0oa1 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records):

>d1k0oa1 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
sqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefast
cpddeeielayeqvakalk

Timeline for d1k0oa1:

• d1k0oa1 is new in SCOP 1.59
  
• d1k0oa1 appears in SCOP 1.61
  
• d1k0oa1 appears in the current release, SCOPe 2.08