SCOP 1.59: Domain d1k0oa2: 1k0o A:6-91

Lineage for d1k0oa2 (1k0o A:6-91)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69514] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69515] (3 PDB entries)

8. Domain d1k0oa2: 1k0o A:6-91 [67958]
   Other proteins in same PDB: d1k0oa1, d1k0ob1

Details for d1k0oa2

PDB Entry: 1k0o, 1.75 Å

PDB Description: crystal structure of a soluble form of clic1. an intracellular chloride ion channel

SCOP Domain Sequences for d1k0oa2:

Sequence; same for both SEQRES and ATOM records:

>d1k0oa2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp
fllygtevhtdtnkieefleavlcpp

Timeline for d1k0oa2:

• d1k0oa2 is new in SCOP 1.59
  
• d1k0oa2 appears in SCOP 1.61
  
• d1k0oa2 appears in the current release, SCOPe 2.08