Lineage for d1k0nb1 (1k0n B:92-241)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915610Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 915611Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries)
  8. 915619Domain d1k0nb1: 1k0n B:92-241 [67955]
    Other proteins in same PDB: d1k0na2, d1k0nb2
    complexed with gsh

Details for d1k0nb1

PDB Entry: 1k0n (more details), 1.8 Å

PDB Description: chloride intracellular channel 1 (clic1) complexed with glutathione
PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1k0nb1:

Sequence, based on SEQRES records: (download)

>d1k0nb1 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records): (download)

>d1k0nb1 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsprkfl
dgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddee
ielayeqvakalk

SCOPe Domain Coordinates for d1k0nb1:

Click to download the PDB-style file with coordinates for d1k0nb1.
(The format of our PDB-style files is described here.)

Timeline for d1k0nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0nb2