SCOP 1.59: Domain d1k0mb1: 1k0m B:92-241

Lineage for d1k0mb1 (1k0m B:92-241)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69034] (3 PDB entries)

8. Domain d1k0mb1: 1k0m B:92-241 [67951]
   Other proteins in same PDB: d1k0ma2, d1k0mb2

Details for d1k0mb1

PDB Entry: 1k0m, 1.4 Å

PDB Description: crystal structure of a soluble monomeric form of clic1 at 1.4 angstroms

SCOP Domain Sequences for d1k0mb1:

Sequence; same for both SEQRES and ATOM records:

>d1k0mb1 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Timeline for d1k0mb1:

• d1k0mb1 is new in SCOP 1.59
  
• d1k0mb1 appears in SCOP 1.61
  
• d1k0mb1 appears in the current release, SCOPe 2.08