Lineage for d1jyzp2 (1jyz P:626-730)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762806Domain d1jyzp2: 1jyz P:626-730 [67626]
    Other proteins in same PDB: d1jyzi3, d1jyzi4, d1jyzi5, d1jyzj3, d1jyzj4, d1jyzj5, d1jyzk3, d1jyzk4, d1jyzk5, d1jyzl3, d1jyzl4, d1jyzl5, d1jyzm3, d1jyzm4, d1jyzm5, d1jyzn3, d1jyzn4, d1jyzn5, d1jyzo3, d1jyzo4, d1jyzo5, d1jyzp3, d1jyzp4, d1jyzp5
    complexed with 2fl, mg, na
    complexed with 2fl, mg, na

Details for d1jyzp2

PDB Entry: 1jyz (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains i-p, see remark 400.
PDB Compounds: (P:) beta-galactosidase

SCOPe Domain Sequences for d1jyzp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyzp2 b.1.4.1 (P:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1jyzp2:

Click to download the PDB-style file with coordinates for d1jyzp2.
(The format of our PDB-style files is described here.)

Timeline for d1jyzp2: