Lineage for d1jyzj3 (1jyz J:3-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774416Domain d1jyzj3: 1jyz J:3-219 [67597]
    Other proteins in same PDB: d1jyzi1, d1jyzi2, d1jyzi4, d1jyzi5, d1jyzj1, d1jyzj2, d1jyzj4, d1jyzj5, d1jyzk1, d1jyzk2, d1jyzk4, d1jyzk5, d1jyzl1, d1jyzl2, d1jyzl4, d1jyzl5, d1jyzm1, d1jyzm2, d1jyzm4, d1jyzm5, d1jyzn1, d1jyzn2, d1jyzn4, d1jyzn5, d1jyzo1, d1jyzo2, d1jyzo4, d1jyzo5, d1jyzp1, d1jyzp2, d1jyzp4, d1jyzp5
    complexed with 2fl, mg, na
    complexed with 2fl, mg, na

Details for d1jyzj3

PDB Entry: 1jyz (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains i-p, see remark 400.
PDB Compounds: (J:) beta-galactosidase

SCOPe Domain Sequences for d1jyzj3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyzj3 b.18.1.5 (J:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jyzj3:

Click to download the PDB-style file with coordinates for d1jyzj3.
(The format of our PDB-style files is described here.)

Timeline for d1jyzj3: