Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
Domain d1jyzn4: 1jyz N:731-1023 [67618] Other proteins in same PDB: d1jyzi1, d1jyzi2, d1jyzi3, d1jyzi5, d1jyzj1, d1jyzj2, d1jyzj3, d1jyzj5, d1jyzk1, d1jyzk2, d1jyzk3, d1jyzk5, d1jyzl1, d1jyzl2, d1jyzl3, d1jyzl5, d1jyzm1, d1jyzm2, d1jyzm3, d1jyzm5, d1jyzn1, d1jyzn2, d1jyzn3, d1jyzn5, d1jyzo1, d1jyzo2, d1jyzo3, d1jyzo5, d1jyzp1, d1jyzp2, d1jyzp3, d1jyzp5 complexed with 2fl, mg, na complexed with 2fl, mg, na |
PDB Entry: 1jyz (more details), 2.7 Å
SCOPe Domain Sequences for d1jyzn4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyzn4 b.30.5.1 (N:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1jyzn4:
View in 3D Domains from same chain: (mouse over for more information) d1jyzn1, d1jyzn2, d1jyzn3, d1jyzn5 |
View in 3D Domains from other chains: (mouse over for more information) d1jyzi1, d1jyzi2, d1jyzi3, d1jyzi4, d1jyzi5, d1jyzj1, d1jyzj2, d1jyzj3, d1jyzj4, d1jyzj5, d1jyzk1, d1jyzk2, d1jyzk3, d1jyzk4, d1jyzk5, d1jyzl1, d1jyzl2, d1jyzl3, d1jyzl4, d1jyzl5, d1jyzm1, d1jyzm2, d1jyzm3, d1jyzm4, d1jyzm5, d1jyzo1, d1jyzo2, d1jyzo3, d1jyzo4, d1jyzo5, d1jyzp1, d1jyzp2, d1jyzp3, d1jyzp4, d1jyzp5 |