Lineage for d1jyyg4 (1jyy G:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781817Domain d1jyyg4: 1jyy G:731-1023 [67583]
    Other proteins in same PDB: d1jyya1, d1jyya2, d1jyya3, d1jyya5, d1jyyb1, d1jyyb2, d1jyyb3, d1jyyb5, d1jyyc1, d1jyyc2, d1jyyc3, d1jyyc5, d1jyyd1, d1jyyd2, d1jyyd3, d1jyyd5, d1jyye1, d1jyye2, d1jyye3, d1jyye5, d1jyyf1, d1jyyf2, d1jyyf3, d1jyyf5, d1jyyg1, d1jyyg2, d1jyyg3, d1jyyg5, d1jyyh1, d1jyyh2, d1jyyh3, d1jyyh5
    complexed with 2fl, mg, na
    complexed with 2fl, mg, na

Details for d1jyyg4

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.
PDB Compounds: (G:) beta-galactosidase

SCOPe Domain Sequences for d1jyyg4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyyg4 b.30.5.1 (G:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jyyg4:

Click to download the PDB-style file with coordinates for d1jyyg4.
(The format of our PDB-style files is described here.)

Timeline for d1jyyg4: