Lineage for d1jyye5 (1jyy E:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830838Domain d1jyye5: 1jyy E:334-625 [67574]
    Other proteins in same PDB: d1jyya1, d1jyya2, d1jyya3, d1jyya4, d1jyyb1, d1jyyb2, d1jyyb3, d1jyyb4, d1jyyc1, d1jyyc2, d1jyyc3, d1jyyc4, d1jyyd1, d1jyyd2, d1jyyd3, d1jyyd4, d1jyye1, d1jyye2, d1jyye3, d1jyye4, d1jyyf1, d1jyyf2, d1jyyf3, d1jyyf4, d1jyyg1, d1jyyg2, d1jyyg3, d1jyyg4, d1jyyh1, d1jyyh2, d1jyyh3, d1jyyh4
    complexed with 2fl, mg, na
    complexed with 2fl, mg, na

Details for d1jyye5

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.
PDB Compounds: (E:) beta-galactosidase

SCOPe Domain Sequences for d1jyye5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyye5 c.1.8.3 (E:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1jyye5:

Click to download the PDB-style file with coordinates for d1jyye5.
(The format of our PDB-style files is described here.)

Timeline for d1jyye5: