SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jyyc2 (1jyy C:626-730)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2030012Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2030013Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 protein domains)
  6. 2030014Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2030028Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2030418Domain d1jyyc2: 1jyy C:626-730 [67561]
    Other proteins in same PDB: d1jyya3, d1jyya4, d1jyya5, d1jyyb3, d1jyyb4, d1jyyb5, d1jyyc3, d1jyyc4, d1jyyc5, d1jyyd3, d1jyyd4, d1jyyd5, d1jyye3, d1jyye4, d1jyye5, d1jyyf3, d1jyyf4, d1jyyf5, d1jyyg3, d1jyyg4, d1jyyg5, d1jyyh3, d1jyyh4, d1jyyh5
    complexed with 2fl, mg, na
    complexed with 2fl, mg, na

Details for d1jyyc2

PDB Entry: 1jyy (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jyyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyyc2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1jyyc2:

Click to download the PDB-style file with coordinates for d1jyyc2.
(The format of our PDB-style files is described here.)

Timeline for d1jyyc2: