Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Psd-95 [69248] (1 species) associates with a guanylate kinase domain |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries) |
Domain d1jxma1: 1jxm A:430-525 [67420] Other proteins in same PDB: d1jxma2 complexed with 5gp, gai, mpd |
PDB Entry: 1jxm (more details), 2 Å
SCOPe Domain Sequences for d1jxma1:
Sequence, based on SEQRES records: (download)
>d1jxma1 b.34.2.1 (A:430-525) Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]} gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip skrrverrewsrlkakdwgsssgsqgredsvlsyet
>d1jxma1 b.34.2.1 (A:430-525) Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]} gfyiralfdycgflsqalsfrfgdvlhvidagdeewwqarrvgfipskrrverrewsrlv lsyet
Timeline for d1jxma1: