Lineage for d1jxma1 (1jxm A:430-525)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109509Protein Psd-95 [69248] (1 species)
  7. 109510Species Rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries)
  8. 109512Domain d1jxma1: 1jxm A:430-525 [67420]
    Other proteins in same PDB: d1jxma2

Details for d1jxma1

PDB Entry: 1jxm (more details), 2 Å

PDB Description: crystal structure of the gmp bound sh3-hook-gk fragment of psd-95

SCOP Domain Sequences for d1jxma1:

Sequence, based on SEQRES records: (download)

>d1jxma1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus)}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkakdwgsssgsqgredsvlsyet

Sequence, based on observed residues (ATOM records): (download)

>d1jxma1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus)}
gfyiralfdycgflsqalsfrfgdvlhvidagdeewwqarrvgfipskrrverrewsrlv
lsyet

SCOP Domain Coordinates for d1jxma1:

Click to download the PDB-style file with coordinates for d1jxma1.
(The format of our PDB-style files is described here.)

Timeline for d1jxma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxma2