SCOP 1.63: Domain d1jwya1: 1jwy A:36-79

Lineage for d1jwya1 (1jwy A:36-79)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)

8. Domain d1jwya1: 1jwy A:36-79 [67399]
   Other proteins in same PDB: d1jwya2, d1jwyb_
   complexed with adp, gdp, glc, mg

Details for d1jwya1

PDB Entry: 1jwy, 2.3 Å

PDB Description: crystal structure of the dynamin a gtpase domain complexed with gdp, determined as myosin fusion

SCOP Domain Sequences for d1jwya1:

Sequence; same for both SEQRES and ATOM records:

>d1jwya1 b.34.3.1 (A:36-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
fkltvsdkryiwynpdpkerdsyecgeivsetsdsftfktvdgq

Timeline for d1jwya1:

• d1jwya1 first appeared in SCOP 1.59
  
• d1jwya1 appears in SCOP 1.61
  
• d1jwya1 appears in SCOP 1.65
  
• d1jwya1 appears in the current release, SCOPe 2.08