Lineage for d1jwib_ (1jwi B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607635Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2607656Species Puff adder (Bitis arietans), bitiscetin [TaxId:8692] [88872] (2 PDB entries)
  8. 2607657Domain d1jwib_: 1jwi B: [67384]
    Other proteins in same PDB: d1jwia_

Details for d1jwib_

PDB Entry: 1jwi (more details), 2 Å

PDB Description: Crystal Structure of Bitiscetin, a von Willeband Factor-dependent Platelet Aggregation Inducer.
PDB Compounds: (B:) platelet aggregation inducer

SCOPe Domain Sequences for d1jwib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]}
gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
yrv

SCOPe Domain Coordinates for d1jwib_:

Click to download the PDB-style file with coordinates for d1jwib_.
(The format of our PDB-style files is described here.)

Timeline for d1jwib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jwia_