Lineage for d1jwib_ (1jwi B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139425Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 139426Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 139427Family d.169.1.1: C-type lectin domain [56437] (17 proteins)
  6. 139569Protein Snake coagglutinin [56446] (5 species)
  7. 139582Species Puff adder (Bitis arientans), bitiscetin [69854] (1 PDB entry)
  8. 139584Domain d1jwib_: 1jwi B: [67384]

Details for d1jwib_

PDB Entry: 1jwi (more details), 2 Å

PDB Description: Crystal Structure of Bitiscetin, a von Willeband Factor-dependent Platelet Aggregation Inducer.

SCOP Domain Sequences for d1jwib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwib_ d.169.1.1 (B:) Snake coagglutinin {Puff adder (Bitis arientans), bitiscetin}
gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
yrv

SCOP Domain Coordinates for d1jwib_:

Click to download the PDB-style file with coordinates for d1jwib_.
(The format of our PDB-style files is described here.)

Timeline for d1jwib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jwia_