Lineage for d1jw8a_ (1jw8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688099Domain d1jw8a_: 1jw8 A: [67376]
    complexed with cmo, hem, so4

Details for d1jw8a_

PDB Entry: 1jw8 (more details), 1.3 Å

PDB Description: 1.3 angstrom resolution crystal structure of p6 form of myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1jw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jw8a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1jw8a_:

Click to download the PDB-style file with coordinates for d1jw8a_.
(The format of our PDB-style files is described here.)

Timeline for d1jw8a_: