Lineage for d1jvoj_ (1jvo J:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224390Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 224416Protein Azurin [49530] (6 species)
  7. 224445Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)
  8. 224557Domain d1jvoj_: 1jvo J: [67368]

Details for d1jvoj_

PDB Entry: 1jvo (more details), 2.75 Å

PDB Description: azurin dimer, crosslinked via disulfide bridge

SCOP Domain Sequences for d1jvoj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvoj_ b.6.1.1 (J:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpkcvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1jvoj_:

Click to download the PDB-style file with coordinates for d1jvoj_.
(The format of our PDB-style files is described here.)

Timeline for d1jvoj_: