Lineage for d1ju4a2 (1ju4 A:5-351)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508774Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)
  6. 2508814Protein Bacterial cocaine esterase N-terminal domain [69582] (1 species)
  7. 2508815Species Rhodococcus sp. mb1 [TaxId:51612] [69583] (4 PDB entries)
  8. 2508817Domain d1ju4a2: 1ju4 A:5-351 [67303]
    Other proteins in same PDB: d1ju4a1
    complexed with bez

Details for d1ju4a2

PDB Entry: 1ju4 (more details), 1.63 Å

PDB Description: bacterial cocaine esterase complex with product
PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d1ju4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ju4a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}
nysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwlefvr
dgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylgvtqw
qaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsdarpe
daadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislferl
gglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgiaat
ypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdw

SCOPe Domain Coordinates for d1ju4a2:

Click to download the PDB-style file with coordinates for d1ju4a2.
(The format of our PDB-style files is described here.)

Timeline for d1ju4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ju4a1