Lineage for d1jtyb1 (1jty B:2-72)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351237Superfamily a.4.1: Homeodomain-like [46689] (12 families) (S)
    consists only of helices
  5. 351487Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (5 proteins)
  6. 351502Protein Multidrug binding protein QacR [68964] (1 species)
  7. 351503Species Staphylococcus aureus [TaxId:1280] [68965] (7 PDB entries)
  8. 351529Domain d1jtyb1: 1jty B:2-72 [67294]
    Other proteins in same PDB: d1jtya2, d1jtyb2, d1jtyd2, d1jtye2

Details for d1jtyb1

PDB Entry: 1jty (more details), 2.97 Å

PDB Description: crystal structure of the multidrug binding transcriptional regulator qacr bound to ethidium

SCOP Domain Sequences for d1jtyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtyb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOP Domain Coordinates for d1jtyb1:

Click to download the PDB-style file with coordinates for d1jtyb1.
(The format of our PDB-style files is described here.)

Timeline for d1jtyb1: