SCOP 1.65: Domain d1jt6d1: 1jt6 D:2-72

Lineage for d1jt6d1 (1jt6 D:2-72)

Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (11 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (3 proteins)
Protein Multidrug binding protein QacR [68964] (1 species)
Species Staphylococcus aureus [TaxId:1280] [68965] (7 PDB entries)
Domain d1jt6d1: 1jt6 D:2-72 [67251]
Other proteins in same PDB: d1jt6a2, d1jt6b2, d1jt6d2, d1jt6e2

Details for d1jt6d1

PDB Entry: 1jt6 (more details), 2.54 Å

PDB Description: crystal structure of the multidrug binding protein qacr bound to dequalinium

SCOP Domain Sequences for d1jt6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt6d1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOP Domain Coordinates for d1jt6d1:

Click to download the PDB-style file with coordinates for d1jt6d1.
(The format of our PDB-style files is described here.)

Timeline for d1jt6d1: