Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Multidrug binding protein QacR [68964] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries) Uniprot P23217 |
Domain d1jt6d1: 1jt6 D:2-72 [67251] Other proteins in same PDB: d1jt6a2, d1jt6b2, d1jt6d2, d1jt6e2 complexed with deq, so4 |
PDB Entry: 1jt6 (more details), 2.54 Å
SCOPe Domain Sequences for d1jt6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jt6d1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw qeqwkkeqika
Timeline for d1jt6d1: