Lineage for d1jt6d1 (1jt6 D:2-72)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 94901Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 95108Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)
  6. 95109Protein Multidrug binding protein QacR [68964] (1 species)
  7. 95110Species Staphylococcus aureus [TaxId:1280] [68965] (6 PDB entries)
  8. 95113Domain d1jt6d1: 1jt6 D:2-72 [67251]
    Other proteins in same PDB: d1jt6a2, d1jt6b2, d1jt6d2, d1jt6e2

Details for d1jt6d1

PDB Entry: 1jt6 (more details), 2.54 Å

PDB Description: Crystal structure of the multidrug binding protein QacR bound to dequalinium
PDB Compounds: (D:)

SCOP Domain Sequences for d1jt6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt6d1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOP Domain Coordinates for d1jt6d1:

Click to download the PDB-style file with coordinates for d1jt6d1.
(The format of our PDB-style files is described here.)

Timeline for d1jt6d1: