Class a: All alpha proteins [46456] (171 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species) |
Species Shewanella frigidimarina [TaxId:56812] [48722] (10 PDB entries) |
Domain d1jrya1: 1jry A:1-102 [67199] Other proteins in same PDB: d1jrya2, d1jrya3, d1jryb2, d1jryb3 |
PDB Entry: 1jry (more details), 2 Å
SCOP Domain Sequences for d1jrya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrya1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina} adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde
Timeline for d1jrya1: