Lineage for d1jrya1 (1jry A:1-102)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101664Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 101665Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 101717Family a.138.1.3: Di-heme elbow motif [48711] (5 proteins)
  6. 101738Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (2 species)
  7. 101739Species Shewanella frigidimarina [TaxId:56812] [48722] (6 PDB entries)
  8. 101742Domain d1jrya1: 1jry A:1-102 [67199]
    Other proteins in same PDB: d1jrya2, d1jrya3, d1jryb2, d1jryb3

Details for d1jrya1

PDB Entry: 1jry (more details), 2 Å

PDB Description: crystal structure of arg402lys mutant flavocytochrome c3 from shewanella frigidimarina

SCOP Domain Sequences for d1jrya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrya1 a.138.1.3 (A:1-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina}
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrde

SCOP Domain Coordinates for d1jrya1:

Click to download the PDB-style file with coordinates for d1jrya1.
(The format of our PDB-style files is described here.)

Timeline for d1jrya1: