| Class b: All beta proteins [48724] (110 folds) |
| Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
| Protein Archaeal homoheptameric Sm protein [63758] (3 species) |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (2 PDB entries) |
| Domain d1jrin_: 1jri N: [67134] |
PDB Entry: 1jri (more details), 2.8 Å
SCOP Domain Sequences for d1jrin_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrin_ b.38.1.1 (N:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisrgk
Timeline for d1jrin_: