Lineage for d1jrid_ (1jri D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109944Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)
  4. 109945Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) (S)
  5. 109946Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 109947Protein Archaeal homoheptameric Sm protein [63758] (3 species)
  7. 109991Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (2 PDB entries)
  8. 110002Domain d1jrid_: 1jri D: [67124]

Details for d1jrid_

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.

SCOP Domain Sequences for d1jrid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrid_ b.38.1.1 (D:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum}
vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
irgdnivyisrgk

SCOP Domain Coordinates for d1jrid_:

Click to download the PDB-style file with coordinates for d1jrid_.
(The format of our PDB-style files is described here.)

Timeline for d1jrid_: